Anti-PKD1L1
Artikelnummer:
ATA-HPA022424
- Bilder (7)
| Artikelname: | Anti-PKD1L1 |
| Artikelnummer: | ATA-HPA022424 |
| Hersteller Artikelnummer: | HPA022424 |
| Alternativnummer: | ATA-HPA022424-100,ATA-HPA022424-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PRO19563 |
| polycystic kidney disease 1 like 1 |
| Anti-PKD1L1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 168507 |
| UniProt: | Q8TDX9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HGLEAHTVFSVFCMSGKPDFHYEFSYQIGNTSKHTLYHGRDTQYYFVLPAGEHLDNYKVMVSTEITDGEGSKVQQCTVVVTVLPRYHGNDCLGEDLYNSSLKNLSTLQLMGSYTE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PKD1L1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human heart shows moderate cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity. |
|
|
Immunohistochemical staining of human adipose tissue shows strong membranous positivity in adipocytes. |
|
|
HPA022424-100ul |
|
|
HPA022424-100ul |
|
|
HPA022424-100ul |
Produktgarantie und fachkundiger Support
