Anti-EFR3A
Artikelnummer:
ATA-HPA022859
- Bilder (8)
| Artikelname: | Anti-EFR3A |
| Artikelnummer: | ATA-HPA022859 |
| Hersteller Artikelnummer: | HPA022859 |
| Alternativnummer: | ATA-HPA022859-100,ATA-HPA022859-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0143 |
| EFR3 homolog A (S. cerevisiae) |
| Anti-EFR3A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23167 |
| UniProt: | Q14156 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | EFR3A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-EFR3A antibody HPA022859 (A) shows similar protein distribution across tissues to independent antibody HPA023092 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-EFR3A antibody HPA022859. |
|
|
Immunohistochemical staining of human testis using Anti-EFR3A antibody HPA022859. |
|
|
Immunohistochemical staining of human kidney using Anti-EFR3A antibody HPA022859. |
|
|
Immunohistochemical staining of human lymph node using Anti-EFR3A antibody HPA022859. |
|
|
HPA022859-100ul |
|
|
HPA022859-100ul |
|
|
HPA022859-100ul |
Produktgarantie und fachkundiger Support
