Anti-CPQ

Artikelnummer: ATA-HPA023235
Artikelname: Anti-CPQ
Artikelnummer: ATA-HPA023235
Hersteller Artikelnummer: HPA023235
Alternativnummer: ATA-HPA023235-100,ATA-HPA023235-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: LDP, PGCP
carboxypeptidase Q
Anti-CPQ
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 10404
UniProt: Q9Y646
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CPQ
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line ASC TERT1 shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry analysis in human thyroid gland and cerebral cortex tissues using Anti-CPQ antibody. Corresponding CPQ RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human thyroid gland shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
HPA023235-100ul
HPA023235-100ul
HPA023235-100ul