Anti-ARSG

Artikelnummer: ATA-HPA023245
Artikelname: Anti-ARSG
Artikelnummer: ATA-HPA023245
Hersteller Artikelnummer: HPA023245
Alternativnummer: ATA-HPA023245-100,ATA-HPA023245-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA1001
arylsulfatase G
Anti-ARSG
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 22901
UniProt: Q96EG1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ARSG
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human colon, liver, lymph node and pancreas using Anti-ARSG antibody HPA023245 (A) shows similar protein distribution across tissues to independent antibody HPA023285 (B).
Immunohistochemical staining of human lymph node using Anti-ARSG antibody HPA023245.
Immunohistochemical staining of human liver using Anti-ARSG antibody HPA023245.
Immunohistochemical staining of human colon using Anti-ARSG antibody HPA023245.
Immunohistochemical staining of human pancreas using Anti-ARSG antibody HPA023245.
HPA023245-100ul
HPA023245-100ul
HPA023245-100ul