Anti-APBB2
Artikelnummer:
ATA-HPA023542
- Bilder (7)
| Artikelname: | Anti-APBB2 |
| Artikelnummer: | ATA-HPA023542 |
| Hersteller Artikelnummer: | HPA023542 |
| Alternativnummer: | ATA-HPA023542-100,ATA-HPA023542-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FE65L, FE65L1, MGC35575 |
| amyloid beta (A4) precursor protein-binding, family B, member 2 |
| Anti-APBB2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 323 |
| UniProt: | Q92870 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRGNHHGTAEEKSQPVQGQASTIIGNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | APBB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria. |
|
|
Immunohistochemical staining of human pancreas shows distinct granular positivity in exocrine cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-APBB2 antibody. Remaining relative intensity is presented. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and LY406673 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406673). |
|
|
HPA023542-100ul |
|
|
HPA023542-100ul |
|
|
HPA023542-100ul |
Produktgarantie und fachkundiger Support
