Anti-LRBA
Artikelnummer:
ATA-HPA023597
- Bilder (7)
| Artikelname: | Anti-LRBA |
| Artikelnummer: | ATA-HPA023597 |
| Hersteller Artikelnummer: | HPA023597 |
| Alternativnummer: | ATA-HPA023597-100,ATA-HPA023597-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BGL, CDC4L, LAB300, LBA |
| LPS-responsive vesicle trafficking, beach and anchor containing |
| Anti-LRBA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 987 |
| UniProt: | P50851 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GGWRVWVDTLSITHSKVTFEIHKENLANIFREQQGKVDEEIGLCSSTSVQAASGIRRDINVSVGSQQPDTKDSPVCPHFTTNGNENSSIEKTSSLESASNIELQTTNTSYEEMKAEQENQELPDEGTLEETL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LRBA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows weak to moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules, as well as weaker positivity in glomeruli. |
|
|
HPA023597-100ul |
|
|
HPA023597-100ul |
|
|
HPA023597-100ul |
Produktgarantie und fachkundiger Support
