Anti-FAT1
Artikelnummer:
ATA-HPA023882
- Bilder (7)
| Artikelname: | Anti-FAT1 |
| Artikelnummer: | ATA-HPA023882 |
| Hersteller Artikelnummer: | HPA023882 |
| Alternativnummer: | ATA-HPA023882-100,ATA-HPA023882-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CDHF7, CDHR8, FAT |
| FAT atypical cadherin 1 |
| Anti-FAT1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2195 |
| UniProt: | Q14517 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human rectum shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in smooth muscle cells and glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes. |
|
|
Immunohistochemical staining of human skin shows moderate membranous positivity in squamous epithelial cells. |
|
|
HPA023882-100ul |
|
|
HPA023882-100ul |
|
|
HPA023882-100ul |
Produktgarantie und fachkundiger Support
