Anti-ATP6V1C1
Artikelnummer:
ATA-HPA023943
- Bilder (7)
| Artikelname: | Anti-ATP6V1C1 |
| Artikelnummer: | ATA-HPA023943 |
| Hersteller Artikelnummer: | HPA023943 |
| Alternativnummer: | ATA-HPA023943-100,ATA-HPA023943-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ATP6C, ATP6D, VATC, Vma5 |
| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 |
| Anti-ATP6V1C1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 528 |
| UniProt: | P21283 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ATP6V1C1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in parietal cells. |
|
|
Western blot analysis in human cell line A-431. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
|
|
HPA023943-100ul |
|
|
HPA023943-100ul |
|
|
HPA023943-100ul |
Produktgarantie und fachkundiger Support
