Anti-RAB11FIP1

Artikelnummer: ATA-HPA024010
Artikelname: Anti-RAB11FIP1
Artikelnummer: ATA-HPA024010
Hersteller Artikelnummer: HPA024010
Alternativnummer: ATA-HPA024010-100,ATA-HPA024010-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ22524, FLJ22622, Rab11-FIP1, RCP
RAB11 family interacting protein 1 (class I)
Anti-RAB11FIP1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 80223
UniProt: Q6WKZ4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ASVPSIDSMMRKLEEMGLNLRKDQKKTKKRVSFSEQLFTEEAVAGAALLVEGHSSCPQELNPAWSVAG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RAB11FIP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Immunohistochemistry analysis in human lung and skeletal muscle tissues using Anti-RAB11FIP1 antibody. Corresponding RAB11FIP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lung shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA024010-100ul
HPA024010-100ul
HPA024010-100ul