Anti-CAAP1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA024029
Artikelname: Anti-CAAP1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA024029
Hersteller Artikelnummer: HPA024029
Alternativnummer: ATA-HPA024029-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C9orf82, CAAP, FLJ13657
caspase activity and apoptosis inhibitor 1
Anti-CAAP1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 79886
UniProt: Q9H8G2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: STDSSSVSGSLQQETKYILPTLEKELFLAEHSDLEEGGLDLTVSLKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CAAP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows distinct cytoplasmic positivity in cells in tubules.
Western blot analysis in control (vector only transfected HEK293T lysate) and CAAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410946).
HPA024029
HPA024029
HPA024029