Anti-MYO10

Artikelnummer: ATA-HPA024223
Artikelname: Anti-MYO10
Artikelnummer: ATA-HPA024223
Hersteller Artikelnummer: HPA024223
Alternativnummer: ATA-HPA024223-100,ATA-HPA024223-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0799
myosin X
Anti-MYO10
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: None
UniProt: Q9HD67
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MYO10
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemical staining of human lymphoid tissues shows weak cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
HPA024223-100ul
HPA024223-100ul