Anti-POPDC2
Artikelnummer:
ATA-HPA024255
- Bilder (7)
| Artikelname: | Anti-POPDC2 |
| Artikelnummer: | ATA-HPA024255 |
| Hersteller Artikelnummer: | HPA024255 |
| Alternativnummer: | ATA-HPA024255-100,ATA-HPA024255-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | POP2 |
| popeye domain containing 2 |
| Anti-POPDC2 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 64091 |
| UniProt: | Q9HBU9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYDISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQATPTSLQQTPPCSTPPATTNFPAPPT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | POPDC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human heart muscle and skeletal muscle tissues using HPA024255 antibody. Corresponding POPDC2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human heart muscle shows moderate membranous positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA024255-100ul |
|
|
HPA024255-100ul |
|
|
HPA024255-100ul |
Produktgarantie und fachkundiger Support
