Anti-CASP6
Artikelnummer:
ATA-HPA024303
- Bilder (8)
| Artikelname: | Anti-CASP6 |
| Artikelnummer: | ATA-HPA024303 |
| Hersteller Artikelnummer: | HPA024303 |
| Alternativnummer: | ATA-HPA024303-100,ATA-HPA024303-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MCH2 |
| caspase 6, apoptosis-related cysteine peptidase |
| Anti-CASP6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 839 |
| UniProt: | P55212 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CASP6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human small intestine and skeletal muscle tissues using Anti-CASP6 antibody. Corresponding CASP6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Western blot analysis using Anti-CASP6 antibody HPA024303 (A) shows similar pattern to independent antibody HPA011337 (B). |
|
|
HPA024303-100ul |
|
|
|
|
|
HPA024303-100ul |
|
|
HPA024303-100ul |
Produktgarantie und fachkundiger Support
