Anti-DNAH17
Artikelnummer:
ATA-HPA024354
| Artikelname: |
Anti-DNAH17 |
| Artikelnummer: |
ATA-HPA024354 |
| Hersteller Artikelnummer: |
HPA024354 |
| Alternativnummer: |
ATA-HPA024354-100,ATA-HPA024354-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Molekularbiologie |
| Applikation: |
ICC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
DNAHL1, DNEL2, FLJ40457 |
| dynein, axonemal, heavy chain 17 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.2 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
8632 |
| UniProt: |
Q9UFH2 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
VFQYIQEVREILHNLQNRMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQAMVAVRKHPG |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
DNAH17 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & plasma membrane. |
![]()
|
HPA024354-100ul |
