Anti-IARS2
Artikelnummer:
ATA-HPA024594
- Bilder (8)
| Artikelname: | Anti-IARS2 |
| Artikelnummer: | ATA-HPA024594 |
| Hersteller Artikelnummer: | HPA024594 |
| Alternativnummer: | ATA-HPA024594-100,ATA-HPA024594-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10326 |
| isoleucyl-tRNA synthetase 2, mitochondrial |
| Anti-IARS2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55699 |
| UniProt: | Q9NSE4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VASQHNLPMDCLVDEDGVFTDVAGPELQNKAVLEEGTDVVIKMLQTAKNLLKEEKLVHSYPYDWRTKKPVVIRASKQWFINITDIKTA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IARS2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-IARS2 antibody HPA024594 (A) shows similar pattern to independent antibody HPA024212 (B). |
|
|
|
|
|
|
|
|
HPA024594-100ul |
|
|
HPA024594-100ul |
|
|
HPA024594-100ul |
Produktgarantie und fachkundiger Support
