Anti-RP1L1

Artikelnummer: ATA-HPA024686
Artikelname: Anti-RP1L1
Artikelnummer: ATA-HPA024686
Hersteller Artikelnummer: HPA024686
Alternativnummer: ATA-HPA024686-100,ATA-HPA024686-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DCDC4B
retinitis pigmentosa 1-like 1
Anti-RP1L1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 94137
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CYLCSDKKPPKTPSGPGRPQERNPTAQQLRDVEGQREAPGTSSSRKSLKTPRRILLIKNMDPRLQQTVVLSHRNTRN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RP1L1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human cerebral cortex, eye, retina, liver and lymph node using Anti-RP1L1 antibody HPA024686 (A) shows similar protein distribution across tissues to independent antibody HPA024744 (B).
Immunohistochemical staining of human cerebral cortex using Anti-RP1L1 antibody HPA024686.
Immunohistochemical staining of human eye, retina using Anti-RP1L1 antibody HPA024686.
Immunohistochemical staining of human liver using Anti-RP1L1 antibody HPA024686.
Immunohistochemical staining of human lymph node using Anti-RP1L1 antibody HPA024686.
HPA024686-100ul
HPA024686-100ul
HPA024686-100ul