Anti-FBLIM1
Artikelnummer:
ATA-HPA025287
- Bilder (7)
| Artikelname: | Anti-FBLIM1 |
| Artikelnummer: | ATA-HPA025287 |
| Hersteller Artikelnummer: | HPA025287 |
| Alternativnummer: | ATA-HPA025287-100,ATA-HPA025287-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAL, FBLP-1, migfilin |
| filamin binding LIM protein 1 |
| Anti-FBLIM1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54751 |
| UniProt: | Q8WUP2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FBLIM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-431 and MCF-7 using Anti-FBLIM1 antibody. Corresponding FBLIM1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FBLIM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402597). |
|
|
HPA025287-100ul |
|
|
|
|
|
HPA025287-100ul |
|
|
HPA025287-100ul |
Produktgarantie und fachkundiger Support
