Anti-RAB3GAP2
Artikelnummer:
ATA-HPA026273
- Bilder (7)
| Artikelname: | Anti-RAB3GAP2 |
| Artikelnummer: | ATA-HPA026273 |
| Hersteller Artikelnummer: | HPA026273 |
| Alternativnummer: | ATA-HPA026273-100,ATA-HPA026273-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69 |
| RAB3 GTPase activating protein subunit 2 (non-catalytic) |
| Anti-RAB3GAP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 25782 |
| UniProt: | Q9H2M9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RAB3GAP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
|
|
|
HPA026273-100ul |
|
|
HPA026273-100ul |
|
|
HPA026273-100ul |
Produktgarantie und fachkundiger Support
