Anti-DNAJC8

Artikelnummer: ATA-HPA026275
Artikelname: Anti-DNAJC8
Artikelnummer: ATA-HPA026275
Hersteller Artikelnummer: HPA026275
Alternativnummer: ATA-HPA026275-100,ATA-HPA026275-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SPF31
DnaJ (Hsp40) homolog, subfamily C, member 8
Anti-DNAJC8
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 22826
UniProt: O75937
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EGSRGGWAGEMAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTDEEIK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC8
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm, cytosol & cytokinetic bridge.
HPA026275-100ul