Anti-HDAC6 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA026321
Artikelname: Anti-HDAC6 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA026321
Hersteller Artikelnummer: HPA026321
Alternativnummer: ATA-HPA026321-100,ATA-HPA026321-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ16239, HD6, JM21, KIAA0901, PPP1R90
histone deacetylase 6
Anti-HDAC6
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 10013
UniProt: Q9UBN7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HDAC6
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
HPA026321
HPA026321
HPA026321