Anti-SNRNP40
Artikelnummer:
ATA-HPA026527
- Bilder (7)
| Artikelname: | Anti-SNRNP40 |
| Artikelnummer: | ATA-HPA026527 |
| Hersteller Artikelnummer: | HPA026527 |
| Alternativnummer: | ATA-HPA026527-100,ATA-HPA026527-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HPRP8BP, PRP8BP, PRPF8BP, SPF38, WDR57 |
| small nuclear ribonucleoprotein 40kDa (U5) |
| Anti-SNRNP40 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9410 |
| UniProt: | Q96DI7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SNRNP40 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human duodenum shows strong nuclear positivity in glandular cells. |
|
|
Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SNRNP40 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA026527-100ul |
|
|
HPA026527-100ul |
|
|
HPA026527-100ul |
Produktgarantie und fachkundiger Support
