Anti-LMAN2L

Artikelnummer: ATA-HPA026600
Artikelname: Anti-LMAN2L
Artikelnummer: ATA-HPA026600
Hersteller Artikelnummer: HPA026600
Alternativnummer: ATA-HPA026600-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp564L2423, VIPL
lectin, mannose-binding 2-like
Anti-LMAN2L
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 81562
UniProt: Q9H0V9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LMAN2L
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Western blot analysis in human cell line EFO-21.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA026600-100ul
HPA026600-100ul
HPA026600-100ul