Anti-PTPDC1

Artikelnummer: ATA-HPA026832
Artikelname: Anti-PTPDC1
Artikelnummer: ATA-HPA026832
Hersteller Artikelnummer: HPA026832
Alternativnummer: ATA-HPA026832-100,ATA-HPA026832-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ37312, PTP9Q22
protein tyrosine phosphatase domain containing 1
Anti-PTPDC1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 138639
UniProt: A2A3K4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GMIFSNEQQFDPLWKRRNVECLQPLTHLKRRLSYSDSDLKRAENLLEQGETPQTVPAQILVGHKPRQQKLISHCYIPQSPEPDLHKEALVRSTLSFWSQSKFGGLEGLKDNGSPIFHGRIIPKEAQQSGAFSADVSGSHSPGE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTPDC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and PTPDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405883).
HPA026832-100ul
HPA026832-100ul
HPA026832-100ul