Anti-SCP2

Artikelnummer: ATA-HPA027135
Artikelname: Anti-SCP2
Artikelnummer: ATA-HPA027135
Hersteller Artikelnummer: HPA027135
Alternativnummer: ATA-HPA027135-100,ATA-HPA027135-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SCP2
sterol carrier protein 2
Anti-SCP2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 6342
UniProt: P22307
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SCP2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western blot analysis using Anti-SCP2 antibody HPA027135 (A) shows similar pattern to independent antibody HPA027317 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA027135-100ul
HPA027135-100ul
HPA027135-100ul