Anti-CDCA7L

Artikelnummer: ATA-HPA027169
Artikelname: Anti-CDCA7L
Artikelnummer: ATA-HPA027169
Hersteller Artikelnummer: HPA027169
Alternativnummer: ATA-HPA027169-100,ATA-HPA027169-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: JPO2, R1, RAM2
cell division cycle associated 7-like
Anti-CDCA7L
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 55536
UniProt: Q96GN5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VRFHSKYFTEELRRIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSIGLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDCA7L
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemical staining of human appendix shows strong nuclear positivity in lymphoid reaction center cells.
Western blot analysis in human cell line NTERA-2.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA027169-100ul
HPA027169-100ul
HPA027169-100ul