Anti-ECM1
Artikelnummer:
ATA-HPA027241
- Bilder (8)
| Artikelname: | Anti-ECM1 |
| Artikelnummer: | ATA-HPA027241 |
| Hersteller Artikelnummer: | HPA027241 |
| Alternativnummer: | ATA-HPA027241-100,ATA-HPA027241-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ECM1 |
| extracellular matrix protein 1 |
| Anti-ECM1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1893 |
| UniProt: | Q16610 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ECM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human epididymis and pancreas tissues using Anti-ECM1 antibody. Corresponding ECM1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human epididymis shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-ECM1 antibody. Corresponding ECM1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
HPA027241-100ul |
|
|
|
|
|
HPA027241-100ul |
|
|
HPA027241-100ul |
Produktgarantie und fachkundiger Support
