Anti-WDR47
Artikelnummer:
ATA-HPA027287
- Bilder (7)
| Artikelname: | Anti-WDR47 |
| Artikelnummer: | ATA-HPA027287 |
| Hersteller Artikelnummer: | HPA027287 |
| Alternativnummer: | ATA-HPA027287-100,ATA-HPA027287-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0893 |
| WD repeat domain 47 |
| Anti-WDR47 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 22911 |
| UniProt: | O94967 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LLYECCVEFCQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAYADLLTPLISKLSPYP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | WDR47 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments. |
|
|
Immunohistochemical staining of human kidney shows distinct cytoplasmic positivity in a subset of renal tubules. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA027287-100ul |
|
|
|
|
|
HPA027287-100ul |
|
|
HPA027287-100ul |
Produktgarantie und fachkundiger Support
