Anti-PABPC4

Artikelnummer: ATA-HPA027301
Artikelname: Anti-PABPC4
Artikelnummer: ATA-HPA027301
Hersteller Artikelnummer: HPA027301
Alternativnummer: ATA-HPA027301-100,ATA-HPA027301-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: APP-1, iPABP
poly(A) binding protein, cytoplasmic 4 (inducible form)
Anti-PABPC4
Klonalität: Polyclonal
Konzentration: 0.8 mg/ml
Isotyp: IgG
NCBI: 8761
UniProt: Q13310
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PABPC4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
HPA027301-100ul
HPA027301-100ul
HPA027301-100ul