Anti-TCP1
Artikelnummer:
ATA-HPA027337
- Bilder (7)
| Artikelname: | Anti-TCP1 |
| Artikelnummer: | ATA-HPA027337 |
| Hersteller Artikelnummer: | HPA027337 |
| Alternativnummer: | ATA-HPA027337-100,ATA-HPA027337-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CCT1, Ccta, D6S230E |
| t-complex 1 |
| Anti-TCP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6950 |
| UniProt: | P17987 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TCP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in seminiferus duct cells. |
|
|
Western blot analysis using Anti-TCP1 antibody HPA027337 (A) shows similar pattern to independent antibody HPA031082 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA027337-100ul |
|
|
|
|
|
HPA027337-100ul |
|
|
HPA027337-100ul |
Produktgarantie und fachkundiger Support
