Anti-CIART
Artikelnummer:
ATA-HPA027515
- Bilder (8)
| Artikelname: | Anti-CIART |
| Artikelnummer: | ATA-HPA027515 |
| Hersteller Artikelnummer: | HPA027515 |
| Alternativnummer: | ATA-HPA027515-100,ATA-HPA027515-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BC017397, C1orf51 |
| circadian associated repressor of transcription |
| Anti-CIART |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 148523 |
| UniProt: | Q8N365 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CIART |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human seminal vesicle and cervix, uterine tissues using Anti-CIART antibody. Corresponding CIART RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human seminal vesicle shows high expression. |
|
|
Immunohistochemical staining of human cervix, uterine shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA027515-100ul |
|
|
HPA027515-100ul |
|
|
HPA027515-100ul |
Produktgarantie und fachkundiger Support
