Anti-MYBPC1

Artikelnummer: ATA-HPA027614
Artikelname: Anti-MYBPC1
Artikelnummer: ATA-HPA027614
Hersteller Artikelnummer: HPA027614
Alternativnummer: ATA-HPA027614-100,ATA-HPA027614-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MYBPC1
myosin binding protein C, slow type
Anti-MYBPC1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 4604
UniProt: Q00872
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MYBPC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-MYBPC1 antibody. Corresponding MYBPC1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, liver, lymph node and skeletal muscle using Anti-MYBPC1 antibody HPA027614 (A) shows similar protein distribution across tissues to independent antibody HPA021004 (B).
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human lymph node using Anti-MYBPC1 antibody HPA027614.
Immunohistochemical staining of human kidney using Anti-MYBPC1 antibody HPA027614.
HPA027614-100ul
HPA027614-100ul
HPA027614-100ul