Anti-DNAH14
Artikelnummer:
ATA-HPA027718
| Artikelname: |
Anti-DNAH14 |
| Artikelnummer: |
ATA-HPA027718 |
| Hersteller Artikelnummer: |
HPA027718 |
| Alternativnummer: |
ATA-HPA027718-100,ATA-HPA027718-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Molekularbiologie |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
C1orf67, DKFZp781B1548, Dnahc14, HL-18, HL18, MGC27277 |
| dynein, axonemal, heavy chain 14 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
127602 |
| UniProt: |
Q0VDD8 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
FIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRR |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
DNAH14 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:50 - 1:200 |
![]()
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
![]()
|
HPA027718-100ul |
