Anti-IDO1
Artikelnummer:
ATA-HPA027772
- Bilder (9)
| Artikelname: | Anti-IDO1 |
| Artikelnummer: | ATA-HPA027772 |
| Hersteller Artikelnummer: | HPA027772 |
| Alternativnummer: | ATA-HPA027772-100,ATA-HPA027772-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IDO, INDO |
| indoleamine 2,3-dioxygenase 1 |
| Anti-IDO1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3620 |
| UniProt: | P14902 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IDO1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and IDO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400784). |
|
|
HPA027772-100ul |
|
|
|
|
|
HPA027772-100ul |
|
|
HPA027772-100ul |
Produktgarantie und fachkundiger Support
