Anti-NEO1
Artikelnummer:
ATA-HPA027806
- Bilder (8)
| Artikelname: | Anti-NEO1 |
| Artikelnummer: | ATA-HPA027806 |
| Hersteller Artikelnummer: | HPA027806 |
| Alternativnummer: | ATA-HPA027806-100,ATA-HPA027806-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HsT17534, IGDCC2, NGN, NTN1R2 |
| neogenin 1 |
| Anti-NEO1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4756 |
| UniProt: | Q92859 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NEO1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane. |
|
|
Immunohistochemical staining of human colon shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-549 and HeLa using Anti-NEO1 antibody. Corresponding NEO1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1. |
|
|
HPA027806-100ul |
|
|
|
|
|
|
|
|
HPA027806-100ul |
|
|
HPA027806-100ul |
Produktgarantie und fachkundiger Support
