Anti-CKAP2
Artikelnummer:
ATA-HPA027821
- Bilder (7)
| Artikelname: | Anti-CKAP2 |
| Artikelnummer: | ATA-HPA027821 |
| Hersteller Artikelnummer: | HPA027821 |
| Alternativnummer: | ATA-HPA027821-100,ATA-HPA027821-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10749, LB1, se20-10, TMAP |
| cytoskeleton associated protein 2 |
| Anti-CKAP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 26586 |
| UniProt: | Q8WWK9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VKYWICLALIEPITSPIENIIAIYEKAILAGAQPIEEMRHTIVDILTMKSQEKANLGENMEKSCASKEEVKEVSIEDTGVDVDPEKLEMESKLHRNLLFQDCEKEQDNKTKDPTH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CKAP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA027821 antibody. Corresponding CKAP2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate positivity. |
|
|
Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA027821-100ul |
|
|
HPA027821-100ul |
|
|
HPA027821-100ul |
Produktgarantie und fachkundiger Support
