Anti-DMRT1
Artikelnummer:
ATA-HPA027850
- Bilder (8)
| Artikelname: | Anti-DMRT1 |
| Artikelnummer: | ATA-HPA027850 |
| Hersteller Artikelnummer: | HPA027850 |
| Alternativnummer: | ATA-HPA027850-100,ATA-HPA027850-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CT154, DMT1 |
| doublesex and mab-3 related transcription factor 1 |
| Anti-DMRT1 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 1761 |
| UniProt: | Q9Y5R6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DMRT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and fallopian tube tissues using Anti-DMRT1 antibody. Corresponding DMRT1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows no nuclear positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411862). |
|
|
HPA027850-100ul |
|
|
|
|
|
HPA027850-100ul |
|
|
HPA027850-100ul |
Produktgarantie und fachkundiger Support
