Anti-NMUR1
Artikelnummer:
ATA-HPA027895
- Bilder (7)
| Artikelname: | Anti-NMUR1 |
| Artikelnummer: | ATA-HPA027895 |
| Hersteller Artikelnummer: | HPA027895 |
| Alternativnummer: | ATA-HPA027895-100,ATA-HPA027895-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FM-3, GPC-R, GPR66, NMU1R |
| neuromedin U receptor 1 |
| Anti-NMUR1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.8 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10316 |
| UniProt: | Q9HB89 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NMUR1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human upper gastrointestinal shows weak to moderate membranous and cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows weak to moderate membranous and cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human fallopian tube shows weak to moderate membranous and cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
HPA027895-100ul |
|
|
HPA027895-100ul |
|
|
HPA027895-100ul |
Produktgarantie und fachkundiger Support
