Anti-METTL11B
Artikelnummer:
ATA-HPA028049
- Bilder (7)
| Artikelname: | Anti-METTL11B |
| Artikelnummer: | ATA-HPA028049 |
| Hersteller Artikelnummer: | HPA028049 |
| Alternativnummer: | ATA-HPA028049-100,ATA-HPA028049-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C1orf184, HOMT1B |
| methyltransferase like 11B |
| Anti-METTL11B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 149281 |
| UniProt: | Q5VVY1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | METTL11B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human thyroid gland shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human rectum shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows weak to moderate nuclear positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
HPA028049-100ul |
|
|
HPA028049-100ul |
|
|
HPA028049-100ul |
Produktgarantie und fachkundiger Support
