Anti-LYSMD1

Artikelnummer: ATA-HPA028055
Artikelname: Anti-LYSMD1
Artikelnummer: ATA-HPA028055
Hersteller Artikelnummer: HPA028055
Alternativnummer: ATA-HPA028055-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MGC35223, RP11-68I18.5, SB145
LysM, putative peptidoglycan-binding, domain containing 1
Anti-LYSMD1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 388695
UniProt: Q96S90
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LYSMD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Western blot analysis in control (vector only transfected HEK293T lysate) and LYSMD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403895).
HPA028055-100ul
HPA028055-100ul
HPA028055-100ul