Anti-WRAP53
Artikelnummer:
ATA-HPA028130
- Bilder (9)
| Artikelname: | Anti-WRAP53 |
| Artikelnummer: | ATA-HPA028130 |
| Hersteller Artikelnummer: | HPA028130 |
| Alternativnummer: | ATA-HPA028130-100,ATA-HPA028130-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10385, TCAB1, WDR79 |
| WD repeat containing, antisense to TP53 |
| Anti-WRAP53 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 55135 |
| UniProt: | Q9BUR4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | WRAP53 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human fallopian tube and kidney tissues using Anti-WRAP53 antibody. Corresponding WRAP53 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube, kidney, liver and skin using Anti-WRAP53 antibody HPA028130 (A) shows similar protein distribution across tissues to independent antibody HPA023026 (B). |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human skin using Anti-WRAP53 antibody HPA028130. |
|
|
Immunohistochemical staining of human liver using Anti-WRAP53 antibody HPA028130. |
|
|
HPA028130-100ul |
|
|
HPA028130-100ul |
|
|
HPA028130-100ul |
Produktgarantie und fachkundiger Support
