Anti-DNALI1
Artikelnummer:
ATA-HPA028305
- Bilder (6)
| Artikelname: | Anti-DNALI1 |
| Artikelnummer: | ATA-HPA028305 |
| Hersteller Artikelnummer: | HPA028305 |
| Alternativnummer: | ATA-HPA028305-100,ATA-HPA028305-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ423B22.5, hp28, P28 |
| dynein, axonemal, light intermediate chain 1 |
| Anti-DNALI1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7802 |
| UniProt: | O14645 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPDPTKQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNALI1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in cilia, as well as moderate cytoplasmic staining in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
HPA028305-100ul |
|
|
HPA028305-100ul |
|
|
HPA028305-100ul |
Produktgarantie und fachkundiger Support
