Anti-MRPL18
Artikelnummer:
ATA-HPA028775
- Bilder (8)
| Artikelname: | Anti-MRPL18 |
| Artikelnummer: | ATA-HPA028775 |
| Hersteller Artikelnummer: | HPA028775 |
| Alternativnummer: | ATA-HPA028775-100,ATA-HPA028775-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HSPC071 |
| mitochondrial ribosomal protein L18 |
| Anti-MRPL18 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 29074 |
| UniProt: | Q9H0U6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MRPL18 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-MRPL18 antibody HPA028775 (A) shows similar protein distribution across tissues to independent antibody HPA028774 (B). |
|
|
Immunohistochemical staining of human lymph node using Anti-MRPL18 antibody HPA028775. |
|
|
Immunohistochemical staining of human kidney using Anti-MRPL18 antibody HPA028775. |
|
|
Immunohistochemical staining of human colon using Anti-MRPL18 antibody HPA028775. |
|
|
Immunohistochemical staining of human liver using Anti-MRPL18 antibody HPA028775. |
|
|
HPA028775-100ul |
|
|
HPA028775-100ul |
|
|
HPA028775-100ul |
Produktgarantie und fachkundiger Support
