Anti-MOGAT2
Artikelnummer:
ATA-HPA028834
- Bilder (8)
| Artikelname: | Anti-MOGAT2 |
| Artikelnummer: | ATA-HPA028834 |
| Hersteller Artikelnummer: | HPA028834 |
| Alternativnummer: | ATA-HPA028834-100,ATA-HPA028834-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DGAT2L5, FLJ22644, MGAT2 |
| monoacylglycerol O-acyltransferase 2 |
| Anti-MOGAT2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80168 |
| UniProt: | Q3SYC2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MOGAT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and MOGAT2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403049). |
|
|
HPA028834-100ul |
|
|
|
|
|
HPA028834-100ul |
|
|
HPA028834-100ul |
Produktgarantie und fachkundiger Support
