Anti-LMLN
Artikelnummer:
ATA-HPA028844
| Artikelname: |
Anti-LMLN |
| Artikelnummer: |
ATA-HPA028844 |
| Hersteller Artikelnummer: |
HPA028844 |
| Alternativnummer: |
ATA-HPA028844-100,ATA-HPA028844-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC, IHC, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Gp63, Msp |
| leishmanolysin-like (metallopeptidase M8 family) |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
89782 |
| UniProt: |
Q96KR4 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
FDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWDFC |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
LMLN |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & focal adhesion sites. |
|
Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts. |
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
HPA028844-100ul |
|
HPA028844 |
|
HPA028844 |
|
HPA028844-100ul |
|
HPA028844-100ul |