Anti-BHLHE40
Artikelnummer:
ATA-HPA028922
- Bilder (9)
| Artikelname: | Anti-BHLHE40 |
| Artikelnummer: | ATA-HPA028922 |
| Hersteller Artikelnummer: | HPA028922 |
| Alternativnummer: | ATA-HPA028922-100,ATA-HPA028922-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BHLHB2, bHLHe40, DEC1, STRA13 |
| basic helix-loop-helix family, member e40 |
| Anti-BHLHE40 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8553 |
| UniProt: | O14503 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BHLHE40 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear bodies. |
|
|
Immunohistochemical staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells. |
|
|
Western blot analysis in human cell line HDLM-2. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and BHLHE40 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418509). |
|
|
HPA028922-100ul |
|
|
|
|
|
|
|
|
HPA028922-100ul |
|
|
HPA028922-100ul |
Produktgarantie und fachkundiger Support
