Anti-BECN1
Artikelnummer:
ATA-HPA028949
- Bilder (9)
| Artikelname: | Anti-BECN1 |
| Artikelnummer: | ATA-HPA028949 |
| Hersteller Artikelnummer: | HPA028949 |
| Alternativnummer: | ATA-HPA028949-100,ATA-HPA028949-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ATG6, VPS30 |
| beclin 1, autophagy related |
| Anti-BECN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8678 |
| UniProt: | Q14457 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BECN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells. |
|
|
Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA028949-100ul |
|
|
|
|
|
HPA028949-100ul |
|
|
HPA028949-100ul |
Produktgarantie und fachkundiger Support
