Anti-APLP1
Artikelnummer:
ATA-HPA028970
- Bilder (8)
| Artikelname: | Anti-APLP1 |
| Artikelnummer: | ATA-HPA028970 |
| Hersteller Artikelnummer: | HPA028970 |
| Alternativnummer: | ATA-HPA028970-100,ATA-HPA028970-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APLP |
| amyloid beta (A4) precursor-like protein 1 |
| Anti-APLP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 333 |
| UniProt: | P51693 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HLAQELRPQIQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSLGAPHR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | APLP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-APLP1 antibody. Corresponding APLP1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and APLP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401581). |
|
|
HPA028970-100ul |
|
|
|
|
|
HPA028970-100ul |
|
|
HPA028970-100ul |
Produktgarantie und fachkundiger Support
