Anti-SMYD2
Artikelnummer:
ATA-HPA029023
- Bilder (8)
| Artikelname: | Anti-SMYD2 |
| Artikelnummer: | ATA-HPA029023 |
| Hersteller Artikelnummer: | HPA029023 |
| Alternativnummer: | ATA-HPA029023-100,ATA-HPA029023-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HSKM-B, KMT3C, ZMYND14 |
| SET and MYND domain containing 2 |
| Anti-SMYD2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 56950 |
| UniProt: | Q9NRG4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SMYD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human uterine cervix shows moderate to strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human pancreas shows weak nuclear positivity in glandular cells. |
|
|
HPA029023-100ul |
|
|
|
|
|
HPA029023-100ul |
|
|
HPA029023-100ul |
Produktgarantie und fachkundiger Support
