Anti-MRPS10
Artikelnummer:
ATA-HPA029133
- Bilder (8)
| Artikelname: | Anti-MRPS10 |
| Artikelnummer: | ATA-HPA029133 |
| Hersteller Artikelnummer: | HPA029133 |
| Alternativnummer: | ATA-HPA029133-100,ATA-HPA029133-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10567 |
| mitochondrial ribosomal protein S10 |
| Anti-MRPS10 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55173 |
| UniProt: | P82664 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MRPS10 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human esophagus and pancreas tissues using Anti-MRPS10 antibody. Corresponding MRPS10 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human esophagus shows high expression. |
|
|
Western blot analysis using Anti-MRPS10 antibody HPA029133 (A) shows similar pattern to independent antibody HPA029134 (B). |
|
|
HPA029133-100ul |
|
|
|
|
|
HPA029133-100ul |
|
|
HPA029133-100ul |
Produktgarantie und fachkundiger Support
