Anti-BCAP29
Artikelnummer:
ATA-HPA029215
- Bilder (9)
| Artikelname: | Anti-BCAP29 |
| Artikelnummer: | ATA-HPA029215 |
| Hersteller Artikelnummer: | HPA029215 |
| Alternativnummer: | ATA-HPA029215-100,ATA-HPA029215-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BAP29, DKFZp686M2086 |
| B-cell receptor-associated protein 29 |
| Anti-BCAP29 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55973 |
| UniProt: | Q9UHQ4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BCAP29 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-BCAP29 antibody. Corresponding BCAP29 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, pancreas, testis and thyroid gland using Anti-BCAP29 antibody HPA029215 (A) shows similar protein distribution across tissues to independent antibody HPA049694 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-BCAP29 antibody HPA029215. |
|
|
Immunohistochemical staining of human thyroid gland using Anti-BCAP29 antibody HPA029215. |
|
|
HPA029215-100ul |
|
|
HPA029215-100ul |
|
|
HPA029215-100ul |
Produktgarantie und fachkundiger Support
